DPCfam | MC178567
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 199 ± 25 aa |
| Residues in low-complexity regions (%) | 3.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.95 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00082 |
| Sequences matching dominant architecture (%) | 94.23 |
| Average overlap percent | 11.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8H2R6 | 33-237 | 205 | LRYEFSTETVPREYIVRYAGYHGNEARACLLSGALAGLPCAWRAVRRDNPAAQHPSDFDLLRLAFNCTPALTAEATRRLLASDAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14703-F1 | 47-248 | 100.00 | 71.72 | View in AlphaFoldDB ↗ |