DPCfam | MC178117
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 74 ± 11 aa |
| Residues in low-complexity regions (%) | 5.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.79 |
| Average transmembrane regions | 1.61 |
| Dominant Pfam architecture(s) | PF02508 |
| Sequences matching dominant architecture (%) | 97.56 |
| Average overlap percent | 37.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6BI33 | 134-194 | 61 | MGLGYTIVLLFIAFFRELLGFGSLFGVQILGEGWVKWTLMIMPPGAFFMLGIVIWITRNVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-H6LC29-F1 | 126-195 | 95.89 | 76.37 | View in AlphaFoldDB ↗ |