DPCfam | MC178090
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 396 ± 65 aa |
| Residues in low-complexity regions (%) | 6.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14215- PF00010 |
| Sequences matching dominant architecture (%) | 88.99 |
| Average overlap percent | 78.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A103XJC2 | 32-450 | 419 | ATMSQTSLQTRLKFILQSRPERWLYAIFWQASKETDGRLVLLWADGYFPGTNSDLPDSRRNGNDHLMLSYDDDVSDSQWLIMSSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O49687-F1 | 62-567 | 99.76 | 68.15 | View in AlphaFoldDB ↗ |