DPCfam | MC177281
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 129 ± 27 aa |
| Residues in low-complexity regions (%) | 19.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00046 |
| Sequences matching dominant architecture (%) | 4.26 |
| Average overlap percent | 5.38 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A7Z343 | 6-127 | 122 | KHTTPFSVSDILSPLEESYKKVSMENNNLGAPLTSYRQPQVSQAAMQQHHMGHNGTVSAAYHMTAAGVSQLSHTAMGGYCNGNLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B3DFT3-F1 | 1-125 | 99.25 | 48.27 | View in AlphaFoldDB ↗ |