DPCfam | MC176731
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Residues in low-complexity regions (%) | 1.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.0 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF15723 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 96.03 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2LYD0 | 7-99 | 93 | EKRRPHYELSLFKELFSNAKTRQITQIAHKGAASEGYMTVEDIENVIEQLGSKHFYKSMTTYHSHEIWQDVYHYQDGDKKLYIKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q46865-F1 | 5-98 | 100.00 | 96.69 | View in AlphaFoldDB ↗ |