DPCfam | MC176609
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Residues in low-complexity regions (%) | 2.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10241 |
| Sequences matching dominant architecture (%) | 97.39 |
| Average overlap percent | 90.46 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A090L074 | 38-130 | 93 | ESLIQCLLSQVDEANVTEIIAFQKICLERLEKTNAMLENCQQISETRLATASRDIAIGRAKIIEIKNDLEYIIRKIATIKKTLKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6DBR9-F1 | 9-98 | 98.90 | 96.81 | View in AlphaFoldDB ↗ |