DPCfam | MC176491
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16199- PF00583 |
| Sequences matching dominant architecture (%) | 53.28 |
| Average overlap percent | 37.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D6J8V3 | 54-141 | 88 | RDIPMPLVTSGVEKGNLRELALARMEDLGLKCRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTRQDILIGLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58536-F1 | 356-440 | 100.00 | 91.50 | View in AlphaFoldDB ↗ |