DPCfam | MC176390
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3311 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Residues in low-complexity regions (%) | 4.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14765 |
| Sequences matching dominant architecture (%) | 99.96 |
| Average overlap percent | 24.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009FD12AE | 1700-1769 | 70 | EECYGRIARMGVRYGPGFRLVHTLLRGVREGRREVLAELRLPEDLRGSLEEHTLHPSVLDAAIHASLGLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FDI6-F1 | 75-135 | 95.45 | 91.13 | View in AlphaFoldDB ↗ |