DPCfam | MC176326
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 196 ± 25 aa |
| Residues in low-complexity regions (%) | 5.01 |
| Residues in coiled-coil regions (%) | 0.25 |
| Predicted disordered residues (%) | 29.91 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183JNL8 | 177-355 | 179 | SYLSAFYYEYEASKTFASRCAQYLNIDVKFCGVLGKCTRFQEKEVANLTVKVNRVVESKDNKTSGNSPLPQIIPLSDDVLLNSVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O36033-F1 | 184-382 | 98.94 | 86.99 | View in AlphaFoldDB ↗ |