DPCfam | MC175755
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 135 ± 27 aa |
| Residues in low-complexity regions (%) | 8.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04981 |
| Sequences matching dominant architecture (%) | 0.72 |
| Average overlap percent | 0.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q22792 | 350-502 | 153 | QVGMSDAQSLSARTHIGHLLSPGDLVMAFDMKNCNVNNATFDAMNIDNVPDAIIVRKVFDRTRRTAKRQWKLKRLVVDGNIVGNE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59PZ4-F1 | 351-505 | 98.63 | 76.19 | View in AlphaFoldDB ↗ |