DPCfam | MC175713
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 167 ± 14 aa |
| Residues in low-complexity regions (%) | 8.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.48 |
| Average transmembrane regions | 4.45 |
| Dominant Pfam architecture(s) | PF03956 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 89.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9JG92 | 184-342 | 159 | LCIMILAIGYGMGLSGEVIRALSKIGARVLVIPVAILVGTTVSAILIGLIFPQITVRESMAIGYGYGWYTYAPICIGHAGHQVAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GM73-F1 | 130-297 | 98.27 | 91.17 | View in AlphaFoldDB ↗ |