DPCfam | MC175548
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 106 ± 17 aa |
| Residues in low-complexity regions (%) | 3.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04851 |
| Sequences matching dominant architecture (%) | 91.53 |
| Average overlap percent | 23.59 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q3K3N6 | 300-427 | 128 | LGKFKTGSRLLVINDEAHHCYLPKSKGKTTDNEEADENERAAVWFTGIKEISQKFKLQSVYDLSATPYYLQGSGYPAYSLFPWVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F8X0-F1 | 187-291 | 86.67 | 71.39 | View in AlphaFoldDB ↗ |