DPCfam | MC175524
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 461 |
|---|---|
| Mean domain length (aa) | 180 ± 17 aa |
| Residues in low-complexity regions (%) | 3.45 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 26.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02120 |
| Sequences matching dominant architecture (%) | 11.44 |
| Average overlap percent | 43.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A168VY18 | 309-489 | 180 | DPVQLKQTETLKSQLLFLQQNADRLELPEIIQQKTEQALNKLTGQQLQNLQSNENLQQFVLHIPFSQSENPKEMTVRWESKKQDG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31745-F1 | 402-555 | 85.71 | 85.69 | View in AlphaFoldDB ↗ |