DPCfam | MC175322
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 1155 ± 232 aa |
| Residues in low-complexity regions (%) | 3.18 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 14.22 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF11865- PF02259 |
| Sequences matching dominant architecture (%) | 69.88 |
| Average overlap percent | 59.86 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D8XQ00 | 403-1460 | 1058 | LLMLQNPERYRSNIGQMMMIVMDMLNAAISRKRAPEQSVFIFLTLFVKAYKESVTSEIKQLLCVLFKTGLSKGLTCVMHKVVRHI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42346-F1 | 393-1666 | 100.00 | 79.09 | View in AlphaFoldDB ↗ |