DPCfam | MC175243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 165 ± 21 aa |
| Residues in low-complexity regions (%) | 4.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.23 |
| Average transmembrane regions | 1.93 |
| Dominant Pfam architecture(s) | PF06703 |
| Sequences matching dominant architecture (%) | 96.8 |
| Average overlap percent | 90.1 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A147B8H3 | 1-156 | 156 | DDAVKKVMTEKFKYVESHRLADGRLAICTIAVGAAMFALLWDYLYPFPESKPVLIGCVLSYFVLMGVLTLYTTFLEKGIFLVAIQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044SBK4-F1 | 8-174 | 97.66 | 84.90 | View in AlphaFoldDB ↗ |