DPCfam | MC17523
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 86 ± 11 aa |
| Residues in low-complexity regions (%) | 3.37 |
| Residues in coiled-coil regions (%) | 6.6 |
| Predicted disordered residues (%) | 8.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E9NQD3 | 532-615 | 84 | DTGSFVQGWYPTMRNAIALLSRTHGILSSRYFDNLAHEIVRACITSLVKAFTLISTKHSPIDGHLFLIKHLLILKDQVSAFDIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0F7W2-F1 | 487-574 | 98.91 | 84.06 | View in AlphaFoldDB ↗ |