DPCfam | MC174841
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Residues in low-complexity regions (%) | 1.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12708 |
| Sequences matching dominant architecture (%) | 91.67 |
| Average overlap percent | 23.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L2FRZ3 | 416-478 | 63 | TIEVPKDIKITGEVWPLLMANGEAFKDQANPKVMLRVGKPGDVGTFEMSDIIVQTQGPQAGAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GZ52-F1 | 604-662 | 100.00 | 97.95 | View in AlphaFoldDB ↗ |