DPCfam | MC174592
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 521 |
|---|---|
| Mean domain length (aa) | 353 ± 41 aa |
| Residues in low-complexity regions (%) | 32.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.94 |
| Average transmembrane regions | 8.58 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H1X158 | 53-421 | 369 | GALTAALAGWIIVTGLSVVGWLAAALAGAAGDMADAVRIGTRLWLLTNGTPAELGSVHWTLVPLGVSLLTVFMMSRFARAAARFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0FCZ2-F1 | 54-390 | 98.22 | 93.37 | View in AlphaFoldDB ↗ |