DPCfam | MC174310
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Residues in low-complexity regions (%) | 1.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.43 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00476 |
| Sequences matching dominant architecture (%) | 94.15 |
| Average overlap percent | 21.97 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8CP37 | 452-554 | 103 | GYFEFHKVPHSTSPGSNVGNVFSKVCTHLFEQGTLWTSRGVEASAKMLEVSRSARYWTNYKKRFNDELPIWYDDDAEFGALAPSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F8W5R6-F1 | 709-823 | 100.00 | 87.20 | View in AlphaFoldDB ↗ |