DPCfam | MC174295
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Residues in low-complexity regions (%) | 14.22 |
| Residues in coiled-coil regions (%) | 28.99 |
| Predicted disordered residues (%) | 23.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q292S8 | 915-985 | 71 | EERKLLECDEAIEAIDAAIEFKNELICGHKSIDTSDRLQREKGEQMLMARLNKLSPEEMRTLLYKYFNKVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58G59-F1 | 1048-1119 | 100.00 | 79.68 | View in AlphaFoldDB ↗ |