DPCfam | MC174250
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2091 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Residues in low-complexity regions (%) | 1.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.58 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00692 |
| Sequences matching dominant architecture (%) | 81.48 |
| Average overlap percent | 80.44 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U1KW86 | 15-144 | 130 | DIKLPIRKTALSAGYDLTIAQDATLFPGKVVLVPTGIKAYMEEDEYLGIHIRSGLAIKHSLSLINGQGIIDADYYNNKENEGHIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G5EET2-F1 | 194-319 | 98.32 | 95.82 | View in AlphaFoldDB ↗ |