DPCfam | MC174053
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 719 ± 112 aa |
| Residues in low-complexity regions (%) | 3.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.35 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF06650 |
| Sequences matching dominant architecture (%) | 53.19 |
| Average overlap percent | 7.71 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A131XRR5 | 1871-2781 | 911 | PLARVVVLQPHAFLSCSPSEQRAEMSCFDVQVGGVPSGFRAPGFNLSELASPGTFVEPWLETRPGESHPKTGIPPSLFTLSLQGF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6LEB4-F1 | 3-72 | 9.83 | 82.78 | View in AlphaFoldDB ↗ |