DPCfam | MC17392
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Residues in low-complexity regions (%) | 0.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09458 |
| Sequences matching dominant architecture (%) | 94.71 |
| Average overlap percent | 84.72 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F4Q3S6 | 74-151 | 78 | SKGEEGRQESFIVPFDNPYPVGIIPKVVAQLKTLDIDNTRVSRINVETSHISNLGFTLTFKTWSNTIVYFVQASYIAH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P05450-F1 | 32-103 | 97.30 | 97.61 | View in AlphaFoldDB ↗ |