DPCfam | MC17388
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 158 ± 16 aa |
| Residues in low-complexity regions (%) | 4.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10373 |
| Sequences matching dominant architecture (%) | 26.09 |
| Average overlap percent | 50.66 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000947E9E7 | 702-858 | 157 | EEKLSCLLKVLTNQGLLPTIKVICDWLKYNTHIIRTCAQSSQSLWTRLATLLNMLPQESQLCGSDAELASVLRGLSQKDWTQGLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R7R1-F1 | 722-879 | 98.74 | 89.97 | View in AlphaFoldDB ↗ |