DPCfam | MC173862
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P0X4Y5 | 15-116 | 102 | AIICFNDRYVSTSLTIYSGFQGQYRLGPEGALRVPSTAAEAFCGGPCLAETERRTWSSATSTPSWTASAFTMAPPSVMSASRLAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1L0U0-F1 | 83-179 | 97.98 | 69.52 | View in AlphaFoldDB ↗ |