DPCfam | MC173861
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 160 ± 30 aa |
| Residues in low-complexity regions (%) | 4.68 |
| Residues in coiled-coil regions (%) | 19.87 |
| Predicted disordered residues (%) | 50.97 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08518- PF16559 |
| Sequences matching dominant architecture (%) | 58.67 |
| Average overlap percent | 90.7 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A016TWT8 | 349-508 | 160 | NQLRQKLAKYDVREFATLIIDVLKEAKRRYFGRPPEDLQETLDTSNVHNLSSNTRMDSGELNRDYDEVADFPGRLGEVRSSGTTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14161-F1 | 320-479 | 99.39 | 71.76 | View in AlphaFoldDB ↗ |