DPCfam | MC173659
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 61 ± 8 aa |
| Residues in low-complexity regions (%) | 2.7 |
| Residues in coiled-coil regions (%) | 1.39 |
| Predicted disordered residues (%) | 10.62 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF02791 |
| Sequences matching dominant architecture (%) | 29.63 |
| Average overlap percent | 71.1 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R3GU61 | 119-179 | 61 | PSQLPRWSIRSMWELASILNFLHVFRPLLNIAVEFSAEEFETALITPNDTLGDIHIPLLKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F4IDY7-F1 | 126-184 | 96.77 | 92.88 | View in AlphaFoldDB ↗ |