DPCfam | MC173565
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 306 ± 45 aa |
| Residues in low-complexity regions (%) | 5.87 |
| Residues in coiled-coil regions (%) | 3.59 |
| Predicted disordered residues (%) | 4.41 |
| Average transmembrane regions | 6.66 |
| Dominant Pfam architecture(s) | PF06814 |
| Sequences matching dominant architecture (%) | 84.27 |
| Average overlap percent | 85.55 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F0VMN8 | 310-618 | 309 | IYFLVASNCGNFKGLTFEGEVAVRNAYGYLPGYEYPKIPFYFLFMLVYLVVCFVWGCLMYRQRANLITFHKFMLVVAVLGFLESL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZWZ9-F1 | 210-519 | 98.36 | 83.82 | View in AlphaFoldDB ↗ |