DPCfam | MC173477
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Residues in low-complexity regions (%) | 2.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.94 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF18084 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 61.33 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2LJV0 | 9-65 | 57 | AVRELVSSCLHRDPVAADLRCSLFVAAAQNYKRDSLLRPFPLRYISGDNKDFEELVR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6NX05-F1 | 16-67 | 94.55 | 94.70 | View in AlphaFoldDB ↗ |