DPCfam | MC17347
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 596 ± 85 aa |
| Residues in low-complexity regions (%) | 2.67 |
| Residues in coiled-coil regions (%) | 1.04 |
| Predicted disordered residues (%) | 20.5 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF14783 |
| Sequences matching dominant architecture (%) | 9.3 |
| Average overlap percent | 17.29 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A088AMJ9 | 9-611 | 603 | DYATVGVTSRRTTKIFPATEHRHTQKFAVADHDGILYVYGMKKGELQLSFKSLPGPKINKLVLGGSGYDKIYIAQGNTVKGYTKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8K2G4-F1 | 9-647 | 99.84 | 92.69 | View in AlphaFoldDB ↗ |