DPCfam | MC173413
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 441 ± 66 aa |
| Residues in low-complexity regions (%) | 23.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 72.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15324 |
| Sequences matching dominant architecture (%) | 96.15 |
| Average overlap percent | 60.76 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00074FC082 | 985-1393 | 409 | VEQEVMARVIGGMYPAQKVAIPDVSSSESEESRAASSDIVEAAGPAGLQLFVSAGVPVDSEAIRHLVNEALAETVAVMLGDREGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1G7G9-F1 | 916-1371 | 99.36 | 46.15 | View in AlphaFoldDB ↗ |