DPCfam | MC173370
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 305 ± 52 aa |
| Residues in low-complexity regions (%) | 4.72 |
| Residues in coiled-coil regions (%) | 0.41 |
| Predicted disordered residues (%) | 3.78 |
| Average transmembrane regions | 4.38 |
| Dominant Pfam architecture(s) | PF05346 |
| Sequences matching dominant architecture (%) | 92.52 |
| Average overlap percent | 72.12 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E1ZIC5 | 270-604 | 335 | GVALCLDSFLAIFTLLPLRVGVALLAVGRSLLAHAKASGGWSGGGESGGRAAGSEPAADRVQRWQVPLRGDQLFDLLVAAMSLGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4VBD2-F1 | 105-413 | 100.00 | 88.84 | View in AlphaFoldDB ↗ |