DPCfam | MC17288
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Residues in low-complexity regions (%) | 27.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 57.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00046 |
| Sequences matching dominant architecture (%) | 67.44 |
| Average overlap percent | 4.72 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1MGW2 | 145-208 | 64 | WRERREGGAGGRPAERQQANRILLQLQQEAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P31314-F1 | 255-316 | 98.55 | 79.47 | View in AlphaFoldDB ↗ |