DPCfam | MC172332
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 252 ± 40 aa |
| Residues in low-complexity regions (%) | 13.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 53.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A2BIH4 | 6-222 | 217 | ELVHIIEDLIIVKVVSIDDNGHSESALGQGTTVYEAEDNAIKRLTERFKSNPETPLSRAKLKDPTSLYKKVAKSGDQTSLPQHNS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42350-F1 | 8-288 | 98.87 | 67.83 | View in AlphaFoldDB ↗ |