DPCfam | MC172291
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 317 ± 52 aa |
| Residues in low-complexity regions (%) | 3.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.95 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03781 |
| Sequences matching dominant architecture (%) | 21.84 |
| Average overlap percent | 43.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5WYQ2 | 2-235 | 234 | KYEAKNVGGVATSTPTGNPWVSINQTNSISACSALGSGYHLITNAEWTSLARHLAAQPSNWSTGIVGSGVLSRGYSASTTNASDG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58CP2-F1 | 143-273 | 43.09 | 96.96 | View in AlphaFoldDB ↗ |