DPCfam | MC172158
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Residues in low-complexity regions (%) | 1.87 |
| Residues in coiled-coil regions (%) | 0.88 |
| Predicted disordered residues (%) | 6.53 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF16399 |
| Sequences matching dominant architecture (%) | 95.52 |
| Average overlap percent | 20.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q555Z2 | 286-395 | 110 | ESLNYCERFLEFMIDLMTQITTRRFFFALFDDFHFILKTSQSEFLKSNDDKSKSVLEGLLGILKVYYNFDIDNFTGEELTKDQAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O60306-F1 | 244-347 | 98.10 | 92.31 | View in AlphaFoldDB ↗ |