DPCfam | MC171975
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Residues in low-complexity regions (%) | 9.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.34 |
| Average transmembrane regions | 1.71 |
| Dominant Pfam architecture(s) | PF03929 |
| Sequences matching dominant architecture (%) | 6.67 |
| Average overlap percent | 34.0 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J1K495 | 5-108 | 104 | QLRKFHRKIAPIIFIPLFLTAFTGMAYRLGRTWMGMPKDKAEILLTIHQGEFLGEGLVPIYVLSIGLGLIAMIFTGLTMVRLAQQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54N78-F1 | 108-189 | 92.13 | 93.99 | View in AlphaFoldDB ↗ |