DPCfam | MC171872
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 840 ± 88 aa |
| Residues in low-complexity regions (%) | 18.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00097 |
| Sequences matching dominant architecture (%) | 34.78 |
| Average overlap percent | 4.71 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C1GNN7 | 70-973 | 904 | ICTDILFQPLTLLDCLHTFCGVCLKEWFSWQVSHPPSSSKSAQATCPSCRAAIRDTRHDAKVTTLLDLFLQSNPHRARGAEEKKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GNN7-F1 | 70-972 | 99.89 | 65.38 | View in AlphaFoldDB ↗ |