DPCfam | MC171749
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 346 ± 61 aa |
| Residues in low-complexity regions (%) | 5.79 |
| Residues in coiled-coil regions (%) | 2.25 |
| Predicted disordered residues (%) | 37.21 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF16064 |
| Sequences matching dominant architecture (%) | 57.29 |
| Average overlap percent | 21.19 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005958D96 | 5-388 | 384 | TWTIIKFTADNTVEAVPSTWIEHSKCYWPPFKYEQIIAAIRKNVERNTCWPSYDIITFRNSTYDDYNVARQKTKKAECTSDLNSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5WUV4-F1 | 7-436 | 100.00 | 70.72 | View in AlphaFoldDB ↗ |