DPCfam | MC171469
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 181 ± 9 aa |
| Residues in low-complexity regions (%) | 1.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13583 |
| Sequences matching dominant architecture (%) | 31.58 |
| Average overlap percent | 22.97 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000762028D | 8-180 | 173 | LHIWLYLHDDVSEMSQITLGDDYLIPLKNELLSFLDLDVKFIIEDTHTPGVTDIDYKVGPEQALVQWRETLQDHGLITWGLHKYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R6Q4-F1 | 328-445 | 57.87 | 84.80 | View in AlphaFoldDB ↗ |