DPCfam | MC171439
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Residues in low-complexity regions (%) | 3.2 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 7.63 |
| Average transmembrane regions | 0.77 |
| Dominant Pfam architecture(s) | PF01851 |
| Sequences matching dominant architecture (%) | 4.73 |
| Average overlap percent | 26.89 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151U1A0 | 1204-1308 | 105 | MDAEAFIQAYVNIITGACISLGLVFAGTRNENAQELLYELAIYFLNEIKPVSPASGKVFPKGLSRYIDRGTLEICLHLIVLSLSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VXV3-F1 | 1526-1620 | 99.00 | 91.46 | View in AlphaFoldDB ↗ |