DPCfam | MC1713
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Residues in low-complexity regions (%) | 2.08 |
| Residues in coiled-coil regions (%) | 69.91 |
| Predicted disordered residues (%) | 40.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17045 |
| Sequences matching dominant architecture (%) | 97.92 |
| Average overlap percent | 28.83 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A28D16E | 7-75 | 69 | VENPDQNVMGSSTCEAELQELMEQIDIMVSNKKMDWERKMRALETRLDLRDQELANAQNCLDQKGQEVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0CB05-F1 | 16-77 | 96.88 | 90.24 | View in AlphaFoldDB ↗ |