DPCfam | MC171217
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 256 ± 30 aa |
| Residues in low-complexity regions (%) | 3.23 |
| Residues in coiled-coil regions (%) | 8.58 |
| Predicted disordered residues (%) | 14.39 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J1HM33 | 142-431 | 290 | TVKPFTPLQIEQLYSNRQIQLIEMFEEEFVDKELKDVYAQDHPLFVLLKKFAKSRSKCLLNLRNISHITSKLDKDYKNIWKIEKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HCE0-F1 | 254-501 | 98.42 | 80.83 | View in AlphaFoldDB ↗ |