DPCfam | MC171193
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Residues in low-complexity regions (%) | 6.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.23 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U9PC73 | 22-140 | 119 | RLRLKPLGPLSGRVDGAWWPRSEDLEAEIPDVLAVLSVRLGPISYVLYKLTEWVKIKSKVPIDGKFVRFGGYHRQPDNTIEIQGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FBG3-F1 | 2-77 | 64.41 | 91.99 | View in AlphaFoldDB ↗ |