DPCfam | MC171172
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15024 |
| Sequences matching dominant architecture (%) | 32.26 |
| Average overlap percent | 57.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S4IIC1 | 696-793 | 98 | EVASTAQGASCDQVCGSYSDKTSKKRWKCSAQSIASLNHCDTLRKHFPCTSCDKMEGAELPSYVSSAESGNFGKCFYSTLDTECS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F4J8A2-F1 | 178-272 | 96.88 | 94.46 | View in AlphaFoldDB ↗ |