DPCfam | MC17106
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 626 ± 75 aa |
| Residues in low-complexity regions (%) | 9.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05383 |
| Sequences matching dominant architecture (%) | 90.62 |
| Average overlap percent | 8.52 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000901D772 | 1-622 | 622 | MVTTKGAGLNPNAKVWQEIPAHQDNIPEEPEDSPWLLTYPPPAEMTDGDLDDSSSGGKGCDTEYPDSTADYAPVPTDGTVNGVDH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZF45-F1 | 42-665 | 97.15 | 54.77 | View in AlphaFoldDB ↗ |