DPCfam | MC170936
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1631 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.56 |
| Predicted disordered residues (%) | 19.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03958 |
| Sequences matching dominant architecture (%) | 87.53 |
| Average overlap percent | 32.58 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00083B7BA1 | 58-124 | 67 | LSERGRAQLDERSNTMVITDEPERLAMIDVLLSELDVPVSQVLVEARIISASLDSARQLGVHWQALE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45778-F1 | 318-379 | 93.94 | 92.11 | View in AlphaFoldDB ↗ |