DPCfam | MC170637
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 531 |
|---|---|
| Mean domain length (aa) | 218 ± 31 aa |
| Residues in low-complexity regions (%) | 6.96 |
| Residues in coiled-coil regions (%) | 1.08 |
| Predicted disordered residues (%) | 2.12 |
| Average transmembrane regions | 6.31 |
| Dominant Pfam architecture(s) | PF05875 |
| Sequences matching dominant architecture (%) | 83.78 |
| Average overlap percent | 92.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4GEN1 | 7-193 | 187 | IGYYVAEFWNTLTNAAYVVVGLCAISRNSKAKQEAHGYSRRAAVCCCLTGVFSGLFHATMWMSFQRLDEMFETGIIVFLYHEHAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NMU0-F1 | 19-271 | 99.05 | 95.32 | View in AlphaFoldDB ↗ |