DPCfam | MC17019
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 204 ± 52 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.7 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12937 |
| Sequences matching dominant architecture (%) | 5.32 |
| Average overlap percent | 2.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067H2B5 | 43-275 | 233 | VIANGLCRQLCLRMFPQLSKVVHVVEQRYGTKDPAEVGSSNFMEWQNLEREHRAYAFLARGCTTFPIRDLISEPICASSTDNYPE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7MIL9-F1 | 99-294 | 98.97 | 89.40 | View in AlphaFoldDB ↗ |