DPCfam | MC170141
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Residues in low-complexity regions (%) | 27.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 50.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00069 |
| Sequences matching dominant architecture (%) | 58.33 |
| Average overlap percent | 4.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004CD8450 | 743-800 | 58 | RPIYPYCPYSPYGSPQGSPRIRRRPLRESRRVSIDNKQGALQLNQYKLLDNIGQGSFG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96RR4-F1 | 119-176 | 98.31 | 61.71 | View in AlphaFoldDB ↗ |